PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma2g02220.1
Common NameZOSMA_2G02220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 527aa    MW: 59426.4 Da    PI: 7.8429
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma2g02220.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.63e-2292140250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                     rien+  rq+tf+kRr g+lKK +ELSvLCda++ +iifs +gk ye +
  Zosma2g02220.1  92 RIENSVHRQITFCKRRSGLLKKGNELSVLCDADIGIIIFSDHGKCYELA 140
                     8********************************************9965 PP

2K-box59.81.2e-201692541698
           K-box  16 slqqelakLkkeienLqreqRhl...lGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      l+qe+a L++ei+ Lq+++R+     Ged++++++ +L +Le++L+  +++iR+ K+++++e+i+ l++ke  l+ +nk L++ +
  Zosma2g02220.1 169 LLEQEIAMLRQEIDLLQNTIRRNpfpFGEDIGNMTMDQLISLEKHLDMWMSHIRTSKTKIMFEEIQLLKHKESTLKATNKILQEDF 254
                     579**************9999853448*******************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.7E-3383142IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-2683161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.65183143IPR002100Transcription factor, MADS-box
CDDcd002651.78E-3284155No hitNo description
PRINTSPR004046.6E-2585105IPR002100Transcription factor, MADS-box
PfamPF003193.9E-2192138IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-25105120IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-25120141IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.15167260IPR002487Transcription factor, K-box
PfamPF014868.1E-20169254IPR002487Transcription factor, K-box
SuperFamilySSF525409.35E-58316496IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene3DG3DSA:3.40.50.3001.4E-69316505IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE profilePS5141935.117317524No hitNo description
SMARTSM001735.3E-23319485No hitNo description
CDDcd018682.01E-120319483No hitNo description
TIGRFAMsTIGR002312.7E-38320479IPR005225Small GTP-binding protein domain
PRINTSPR004493.8E-39322343No hitNo description
SMARTSM001751.3E-107322485No hitNo description
PfamPF000714.1E-58323483IPR001806Small GTPase superfamily
SMARTSM001748.0E-12324484No hitNo description
SMARTSM001769.7E-6327525No hitNo description
PRINTSPR004493.8E-39345361No hitNo description
PRINTSPR004493.8E-39363385No hitNo description
PRINTSPR004493.8E-39425438No hitNo description
PRINTSPR004493.8E-39460482No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007264Biological Processsmall GTPase mediated signal transduction
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005525Molecular FunctionGTP binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MVIVADTENM KKILNSLLRP KSPIMGICIV GWSVGDLVSV CYLLYIYMNL GSCSCRLVLD  60
SLSGSTKQPR IANCVQTPKK NKMARGKVQI RRIENSVHRQ ITFCKRRSGL LKKGNELSVL  120
CDADIGIIIF SDHGKCYELA TKGTMQEMAE RYLNTLPHQM PMPKPKDALL EQEIAMLRQE  180
IDLLQNTIRR NPFPFGEDIG NMTMDQLISL EKHLDMWMSH IRTSKTKIMF EEIQLLKHKE  240
STLKATNKIL QEDFNHYTTV FEDAFVCQDQ IATNPNIGYL NPYEELAIND EIFQFEDGSG  300
REQDRTEPNM DGKSLEDYDY LFKVVLIGDS GVGKSNLLSR FTRNDFCLES KSTIGVEFAT  360
RTVKVEGKTI KAQIWDTAGQ ERYRAITSAY YRGALGAIIV YDVTKSSSFE NVDRWLKELR  420
EHADPNIVVT LIGNKTDLKH LRVVLTDGAE SYSKKEGISF IETSALDSTN VDTSFQMILT  480
EIHRTMTKKN ITVEESGKIT PQGVKKGTAI LMAGSETPAK RKCCSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4uj5_A9e-943124921181RAS-RELATED PROTEIN RAB-11A
4uj5_B9e-943124921181RAS-RELATED PROTEIN RAB-11A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PDA50.0A0A0K9PDA5_Z
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.18e-49AGAMOUS-like 12